Skip to main content
Advertising
Calais Campbell BG Image

Calais Campbell

DL

#93

Experience: 19 years

Height: 6-8

Age: 40

Weight: 307 lbs

College: Miami (Fla.)

2026 SEASON

  • Solo
    0
  • SCK
    0
  • FF
    0
  • INT
    --
Advertising

Preseason

WKGame DateOPPRESULTTotalSoloASTSCKSFTYPDEFINTYDSAVGLNGTDSFFFR
308/28/2026CommandersW 41 - 3
208/22/2026@VikingsW 13 - 3
108/15/2026EaglesW 24 - 7

Regular Season

WKGame DateOPPRESULTTotalSoloASTSCKSFTYPDEFINTYDSAVGLNGTDSFFFR
109/13/2026@ColtsW 41 - 232020000

Biography

KEY TRANSACTIONS
  • Signed a one-year contract extension (through 2021) with the Ravens on 3/21/20
  • Acquired by Baltimore from the Jacksonville Jaguars on 3/19/20 in exchange for a 2020 fifth-round draft choice
  • Signed with Jacksonville as an unrestricted free agent (Ari.) on 3/10/17
  • Re-signed with the Cardinals on 5/10/12
  • Originally selected by the Arizona Cardinals in the second round (50th overall) of the 2008 NFL Draft
HONORS
  • Six-time Pro Bowler (2014-15, 2017-20)
  • NFL All-Decade Team (2010s)
  • NFL Walter Payton Man of the Year (2019)
  • Bart Starr Award (2019)
  • PFWA All-AFC Team (2019)
  • Pro Bowl Defensive MVP Award (2019)
  • Two-time AFC Defensive Player of the Week (Week 6, 2020; Week 3, 2019)
  • AP first-team All-Pro as a DE (2017)
  • PFWA andSporting News Defensive Player of the Year (2017)
  • NFL 101 Awards AFC Defensive Player of the Year (2017)
  • AP second-team All-Pro as a DT (2016-17)
  • NFLPA Community MVP (Nov. 2014, Oct. 2016, Oct. 2019)
  • AP second-team All-Pro as a DE (2014)
  • Pop Warner Humanitarian Award (2015)
CAREER HIGHLIGHTS
  • Has played in 213 (194 starts) during his 14-year career, which both rank as the most among active NFL defensive linemen...Has totaled 764 tackles (55 solo), 93.5 sacks, 161 TFL, 14 FFs, 12 FRs (3 returned for TDs), 55 PD and 3 INTs…His 8 blocked field goals tie Craig Terrill for the third most since the 1970 NFL merger
  • Earning his sixth-overall and fourth-consecutive Pro Bowl nod in 2020, Campbell started all 12 games in which he appeared, producing 28 tackles, 4 sacks, 10 QBHs, 5 TFL and 6 PD for the NFL's No. 2 scoring defense (18.9 ppg) and No. 2 third-down defense (34.0%)
  • Is one of only five active D-linemen with more than 50-career PD (Carlos Dunlap, 68; J.J. Watt, 63; Jason Pierre-Paul, 61; Calais Campbell, 55; Cameron Jordan, 54)
  • Since 2008, his 160 TFL rank No. 2 in the NFL, trailing only J.J. Watt's 179
PERSONAL
  • Grew up in a household of 10 (five brothers, two sisters)
  • While in seventh grade, both his parents lost their jobs as accountants, and the family lived out of a homeless shelter for eight months
  • His younger brother, Jared, played safety at Miami (FL) and spent time with the Cardinals during training camp in 2011...His older brother, Ciare, was a DB at Colorado State from 2004-05, and his brother, Raj, played football at Butte and Orange County Junior Colleges and was a WR at Adams State…His brother, Severin, played football at the University of Montana
  • In 2007, graduated with a degree in sociology from the University of Miami (FL)
2021 SEASON HIGHLIGHTS
  • Played in 15 games (14 starts), producing 49 tackles (29 solo), 12 QBHs, 5 TFL, and 1.5 sacks for the NFL's No. 1 rushing defense (84.5 ypg)
  • Registered 6 tackles, including 1 TFL, vs. Pit. (1/9/22), as Baltimore limited the Steelers to 79 rushing yards
  • Recorded 2 tackles, 1 sack (No. 93.5 of his career) and 2 QBHs vs. Pit. (12/5)
  • Registered 3 tackles, 1 PD and 1 FR in the 16-13 win vs. Chi. (11/21), as Baltimore limited Chicago to 2-of-11 (18.2%) on third down
  • Registered 4 tackles and 2 TFL in the 34-6 win vs. LAC, as Baltimore's defense posted a second-half shutout and limited the Chargers to a season-low 208 total yards (including 26 rushing) and 6 points
  • Posted 4 tackles and 1 TFL in the 31-25 win vs. Ind. (10/11), as Baltimore limited Indianapolis to 1-of-4 (25%) in the red zone…Registered the eighth blocked kick of his career on a fourth-quarter FGA to give Baltimore's offense the ball back just prior to its game-tying TD drive
  • Notched 5 tackles and 3 QBHs in the 23-7 win at Den. (10/3), as Baltimore's defense pitched a second-half shutout and limited the Broncos to a season-low 256 total yards
  • Tallied 4 solo tackles, 2 TFLs and 1 QBH in the 19-17 win at Det. (9/26)…Also protected in field-goal formation during K Justin Tucker's game-winning and NFL-record 66-yard kick
  • Appeared in his 200th-career game, notching 2 tackles (1 solo), in the 36-35 win vs. KC (9/19)…Baltimore limited Kansas City to 1-of-6 (16.7%) on third down
2020: (BALTIMORE RAVENS – 12/12, 2/2)
  • In his first season as a Raven, started all 12 games in which he appeared, producing 28 tackles, 4 sacks, 10 QBHs, 5 TFL and 6 PD for the NFL's No. 2 scoring "D" (18.9 ppg) and No. 2 third-down "D" (34.0%)…Earned his sixth-overall and fourth-consecutive Pro Bowl nod…His 4 sacks led Baltimore's D-line, as he reached that number for the 12-consecutive year, marking the NFL's longest such active streak
  • Recorded 2 tackles in the 20-13 Wild Card Playoff win at Ten. (1/10/21)…Baltimore limited Tennessee to 4-of-12 (33%) on third down and held Derrick Henry to 40 rushing yards on 18 carries (2.2 ypc)
  • Earned AFC Defensive Player of the Week Honors after a standout performance in which he recorded 5 tackles (4 solo) and a game-high 3 sacks and 4 TFL in the 30-28 win at Phi. (10/18)…It marked Campbell's fourth performance of at least 3 sacks in his career, and his 4 TFL matched a career high…Baltimore produced its highest single-game QBHs total (17) since 2006
  • Finished with 2 tackles (all solo) and 1 QBH in the 27-3 win vs. Cin (10/11)…The Ravens finished with 15 QBHs, tying their third-highest output since the stat began being tracked in 2006
  • Batted down a third-down throw, forcing a Washington FGA (54 yards, no good) in the 31-17 win at Was. (10/4)…Also helped limit Washington to 4-of-13 (31%) on third down
  • Delivered his first sack as Raven, adding 5 tackles (2 solo) and a team-high 3 QBHs in the 33-16 win at Hou. (9/20)…Also helped limit the Texans' offense to 5-of-14 (36%) on third down, to Baltimore's 14th-consecutive regular season victory
  • Posted a career-high 3 PD in his Ravens debut, including a deflection that resulted in a CB Marlon Humphrey INT on the team's first-defensive sequence, in the season-opening win vs. Cle. (9/13)
2019: (JACKSONVILLE JAGUARS – 16/16)
  • Started all 16 games for the fifth-consecutive season and for the seventh time in his 12-year career...Collected 56 tackles (37 solo), 10 TFL, 6.5 sacks, 2 FFs, 1 PD, and 1 FR for a TD, en route to his fifth-career and third-consecutive Pro Bowl
  • Scored his third-career TD on an 8-yard return of a FF by DE Yannick Ngakoue in the fourth quarter to help seal a 38-20 victory vs. Ind. (12/29)
  • Recorded back-to-back games with a sack, producing 1 sack and 5 tackles (4 solo) vs. Hou. (11/3)
  • Logged 3 QBHs and 1.5 sacks of Jacksonville's 8 on the day…Helped limit RB Le'Veon Bell to a season-low 23 rushing yards in the Jaguars' 29-15 victory vs. NYJ (10/27)
  • Collected 5 tackles (4 solo) and his first FF of the season vs. NO (10/13)
  • Tied his season high with 6 tackles and blocked a 56-yard FG attempt at Car. (10/6), marking the first blocked FG by a Jaguar since 2015
  • Registered 6 solo tackles, 5 QBHs, 3 sacks and tied a career high with 4 TFL in Jacksonville's first win of the season vs. Ten. (9/19)…Became the first player in franchise history to post multiple games with at least 3 sacks
2018: (JACKSONVILLE JAGUARS – 16/16)
  • Started all 16 games and was selected as a defensive captain by his teammates…Set a single-season career high with 20 TFL, tied a career high with 72 tackles (53 solo) and led the team with 10.5 sacks (-73.5 yards), becoming the first player in Jaguars history to record double-digit sacks in consecutive seasons…Named to his fourth-overall and second-consecutive Pro Bowl
  • Closed the season with three-consecutive games with at least 1 sack…Totaled 7 tackles (5 solo), 1.5 sacks and 1 TFL at Hou. (12/30)
  • Tallied 1 sack, 2 TFL and recovered his own FF in a 17-7 victory at Mia. (12/23)
  • Recorded 7 tackles (6 solo), 1 sack and 2 TFL, helping contain RB Adrian Peterson to 51 yards on 19 carries (2.7 avg.) vs. Was. (12/16)
  • Posted 1 sack, 2 TFL and 1 PD in the franchise's seventh shutout victory vs. Ind. (12/2)…The Jaguars held Indianapolis' offense to 5-of-18 (28%) on third down
  • Notched 4 tackles and 1 sack…Helped hold the Steelers' rushing attack to a season-low 26 yards vs. Pit. (11/18)
  • Registered 5 tackles and produced his second-consecutive game with 2 TFL at Ind. (11/11)
  • Compiled 6 tackles (4 solo), 1 sack and 2 TFL vs. Phi. (10/28)
  • Led the team with a season-high total of 9 tackles (5 solo) vs. Hou. (10/21)
  • Posted 6 tackles (4 solo) and notched his fourth sack through the team's first six games at Dal. (10/14)
  • Produced 5 solo tackles, a season-high 2 sacks and 1 TFL Ten. (9/23)
2017: (JACKSONVILLE JAGUARS – 16/16, 3/3)
  • Started all 16 games and totaled 67 tackles (47 solo), 14.5 sacks, 14 TFL, 3 PD, 3 FFs and 1 FR for league's best pass defense (169.9 ypg.)…His career-best 14.5 sacks (-96 yards) were the second most in the NFL and broke the Jaguars' single-season team record established in 1999 (Tony Brackens, 12)…Named to his third-career Pro Bowl and earned AP All-Pro recognition as a DE and DT…Also named the PFWA Defensive Player of the Year
  • Recorded 6 tackles (3 solo) and 4 QBHs in a Wild Card win vs. Buf. (1/7/18)
  • Wrapped up the regular season with 7 tackles (4 solo) and 2 TFL at Ten. (12/31), marking his fifth performance of the season with at least 2 TFL
  • Recorded a season-high 8 tackles (4 solo) and added 1 PD at SF (12/24)
  • Tallied his fourth multi-sack performance of the 2017 campaign, collecting 5 tackles (4 solo), 2 sacks, 2 TFL and 1 PD in a 45-7 victory vs. Hou. (12/17)
  • Recorded 4 solo tackles, 1 sack and 1 TFL vs. Ind. (12/3)…Reached 12.5 sacks for the season, eclipsing Tony Brackens' single-season franchise record of 12 sacks (1999)
  • Posted a 10-yard scoop-and-score TD, marking the second TD of his career at Ari. (11/26)
  • Notched a half-sack and 1 FF in a 19-7 victory at Cle. (11/19)
  • Posted 1 sack and 2 TFL in the Jaguars' stingiest defensive performance of the season, allowing just 29 rushing yards and 119 passing yards vs. Cin. (11/5)
  • With his second-consecutive 2-sack performance, Campbell reached 10 sacks through seven games, already eclipsing his previous single-season high (9, 2013)…Added 1 TFL and 1 FF in the shutout victory at Ind. (10/22)
  • Registered 6 tackles (3 solo), 1 TFL and 1 sack at NYJ (10/1)
  • Recorded 1 FF and notched a half-sack for a defense that held the Ravens' passing attack to a season-low 52 yards vs. Bal. (9/24)
  • Set a franchise record for most sacks in a single game with 4 at Hou. (9/10)…Campbell's 4 sacks were also a personal single-game career high, and his 3.5 sacks in the first half were the most by a single player in a half since 2015 (LB Khalil Mack, Week 14, 5; DE Cameron Wake, Week 6, 4)
2016: (ARIZONA CARDINALS – 16/16)
  • Started 16 games for the second-consecutive season and fourth time in his career…Totaled 53 tackles (34 solo), 12 TFL and 8 sacks for a Cardinals' defense that led the league in sacks (48.0) and allowed the second-lowest yards per game average in the NFL (305.2 ypg)…Added 2 FFs, a career-high 3 FRs, 1 INT and 6 PD…Returned 1 FR for a TD, reaching the end zone for the first time in his career
  • Tallied 3 tackles (1 solo), 1.5 sacks and 1 TFL in a 44-6 victory to close out the season at LAR (1/1/17)…The Cardinals' defense held the Rams to 2-of-14 on third down (14%)
  • Recovered an aborted snap, notching his second-consecutive game with a FR…Added a half sack of QB Russell Wilson at Sea. (12/24)
  • Registered his first-career TD on a 53-yard scoop-and-score to put Arizona ahead 13-10 vs. NO (12/18)…Added 2 sacks and 2 TFL, marking his second 2-sack, 2-TFL performance of the season
  • Tallied 1 sack, 1 FF and 1 PD vs. Was. (12/4)
  • Recorded a season-high 9 tackles (1 solo) for a defense that allowed a season-low 24 rushing yards against the defending NFC Champions at Car. (10/30)
  • Had a breakout performance at SF (10/6), collecting his first 2 sacks of the season, 1 INT and 2 TFL in the victory
  • Opened the season with a FR vs. NE (9/1)
2015: (ARIZONA CARDINALS – 16/16, 2/2)
  • Started 16 games for the third time in his career and was chosen as a defensive captain for the second-consecutive season…Led the defensive line with 61 tackles (46 solo) and tied for the team lead with 16 TFL…Added 5 sacks, 3 PD and 1 FR, earning Pro Bowl honors for the second-consecutive season…Helped Arizona post a franchise-best 13-3 record
  • Recorded 6 tackles (5 solo), a season-high 2.5 sacks and his fourth 3-TFL output of the season in the Cardinals' ninth-straight victory of the season vs. GB (12/27)
  • Recovered the game-sealing fumble forced by DE Dwight Freeney in a 23-20 victory vs. Min. (12/10)
  • Tied his career high with a team-leading 11 tackles (10 solo)…Added a half-sack and 3 TFL vs. STL (10/4)
2014: (ARIZONA CARDINALS – 14/14, 1/1)
  • Led the defensive line with 58 tackles (48 solo) and 16 TFL, finishing second on the team with 7 sacks…Added 1 INT, 1 FF and 3 PD as a first-time defensive captain for Arizona…Earned his first Pro Bowl selection
  • Closed out the season with 5 tackles (all solo), 2 TFL and 1 PD at SF (12/28)
  • Recorded 6 tackles (5 solo), including a game-sealing fourth-down tackle of WR Jason Avant vs. KC (12/7)…Added 1 sack, 1 TFL and 1 PD
  • Registered a then-career high 3 sacks…Added 6 tackles (4 solo) and 3 TFL at Sea. (11/23)
  • Posted 6 tackles (5 solo), 2 sacks and a season-high 4 TFL vs. STL (11/9)
  • Intercepted QB Peyton Manning and returned it 23 yards to set up Arizona at the Broncos' 5-yard line…RB Andre Ellington punched it into the end zone on the first play following the turnover…Added 1 PD and 1 TFL at Den. (10/5)
  • Set a season high with 10 solo tackles…Added 1 sack and 3 TFL at NYG (9/14)
2013: (ARIZONA CARDINALS – 16/16)
  • Started all 16 games and led the defensive line with 58 tackles (45 solo)…Tied for the team lead with 14 TFL and finished second on the team with a then-career-high 9 sacks…Helped Arizona's rush defense finish as the league's best (84.4 ypg)
  • Finished the season with a 5-tackle (4 solo) and 1-sack performance vs. SF (12/29)
  • Recorded 4 tackles (3 solo), 2 sacks and 2 TFL at Sea. (12/22)
  • Tallied 5 tackles (all solo), 1 sack, 2 TFL and a season-high 2 PD vs Atl. (10/27)
  • Notched a season-high 8 tackles (7 solo), 1 FR and 1 TFL in a Thursday matchup vs. Sea. (10/17)
  • Registered 4 tackles (all solo), 2 sacks, and earned his first-career safety vs. Car. (10/6)…Added 1 FF, which was returned 43 yards by CB Antoine Cason and set up an Arizona TD on the ensuing possession
  • Collected his first sack and first FR of the 2013 campaign vs. Det. (9/15)
2012: (ARIZONA CARDINALS – 13/12)
  • Led the defensive line with 63 tackles (50 solo) and finished No. 2 on the team with 6.5 sacks…Also added 13 TFL, 6 PD and a blocked FG
  • Closed out the season with his third-consecutive 1-sack performance…Added 1 TFL at SF (12/30)
  • Notched his fourth-straight game of 8 tackles (7 solo)…Added 1 sack and 1 PD vs. Chi. (12/23)
  • Tallied 8 tackles (7 solo), 1 sack and tied a career high with 4 TFL vs. Det. (12/16)
  • Collected 8 tackles (5 solo) and a half-sack at GB (11/4)
  • Posted 6 tackles (all solo), 1 sack and 2 TFL vs. SF (10/29)
  • Helped limit the Vikings' passing attack to a season-low 43 yards at Min. (10/21)
  • Registered 5 tackles (all solo) and 2 TFL vs. Buf. (10/14)
  • Recorded a season-high 10 tackles (7 solo), 2 sacks and 2 TFL at NE (9/16)…His second sack occurred on the Patriots' final drive of the game, which resulted in a missed FG
2011: (ARIZONA CARDINALS – 16/16)
  • Started all 16 games for the first time in his career…Set a career high with 72 tackles (53 solo) and posted a team-leading 8 sacks…Added 13 TFL, a career-high 10 PD, 2 FFs, 1 FR and 1 INT…Blocked a career-high 3 FGs, which is tied for the second-highest single-season total in NFL history
  • Collected 7 tackles (4 solo), 1 sack, 1 FF, 1 TFL and 2 PD at Cin. (12/24)
  • Recorded his first-career INT, picking off QB Michael Vick at Phi. (11/13)…Helped limit the Eagles' offense to 3-of-15 (20%) on third down
  • Blocked a 42-yard FG at the end of regulation to send the game into OT…Added 6 tackles (all solo), 2 sacks and a season-high 3 TFL in the overtime victory vs. STL (11/6)
  • Tallied 6 tackles (all solo) and a FF at NYG (10/2)
  • Notched 10 tackles (5 solo) and 2.5 sacks, marking a season high for both categories at Sea. (9/25)
2010: (ARIZONA CARDINALS – 15/15)
  • Started 15 games for the second-consecutive season…Set a then-career high with 60 tackles (46 solo) and registered a team-leading 6 sacks (-49 yards)…Added his first-career FR, 2 PD and 13 TFL
  • Registered his second-consecutive game with a sack in the 27-26 victory at Dal. (12/25)
  • Set a career high with 11 tackles (9 solo) and 4 TFL…Added 1 sack at Car. (12/19)
  • Recovered a QB Kyle Orton fumble, marking the first FR of his career vs. Den. (12/12)
  • Notched a 6-tackle (3 solo), 1-sack and 2-TFL performance vs. Sea. (11/14)
  • Tallied 4 tackles (all solo) and 1 sack at Sea. (10/24)
  • Opened the season with 1 sack, 1 PD and 1 TFL in a victory at STL (9/12)
2009: (ARIZONA CARDINALS – 16/15, 2/1)
  • Saw action in all 16 games (15 starts) and tied DE Darnell Dockett with a team-high 7 sacks…Also recorded 46 tackles (35 solo), 8 TFL, 5 PD and 1 FF…Added special teams contributions, blocking 2 FGs as one of only seven players to block multiple kicks in 2009
  • Registered 1 sack for the second-consecutive game…Added 5 tackles (4 solo) and 1 TFL at SF (12/14)
  • Totaled 4 tackles (3 solo), 1 sack of QB Brett Favre, and 1 TFL in a 30-17 victory vs. Min. (12/6)
  • Recorded 1 FF, knocking the ball loose from a scrambling QB Marc Bulger at STL (11/22)
  • Posted a season-high 7 tackles (6 solo) vs. Car. (11/1)
  • Tallied 3 tackles (2 solo), a season-high 1.5 sacks and 2 TFL at Sea. (10/18)
  • Credited with his first-career sack, recording a half-sack of QB David Garrard…Also blocked a 46-yard FG, resulting in an 83-yard TD return by S Antrel Rolle at Jax. (9/20)
2008: (ARIZONA CARDINALS – 16/0, 4/0)
  • Saw action in all 16 regular season games and four postseason games, including Super Bowl XLIII, in his rookie season...Totaled 21 tackles (17 solo), 2 TFL, 1 PD and 1 FF…Added 8 special teams tackles as a key contributor on that unit
  • Collected 1 tackle in each of Arizona's four postseason games, including Super Bowl XLIII against Pit. (2/1/09)
  • Credited with his first-career FF vs. Dal (10/12)
  • Recorded his first-career tackle in the Cardinals' season opener at SF (9/7)
COLLEGE
  • Played in 36 career games (25 starts) with the Hurricanes before entering the NFL Draft following his junior season
  • Finished his career with 158 tackles, 19.5 sacks, 37.5 TFL, 5 FFs, 3 FRs and 1 INT
  • Started all 12 games at DE as a junior, finishing the season with 50 tackles and a team-high 12 TFL…Added 6.5 sacks, 2 FFs, 2 FRs and his first-career INT
  • Started 12 of 13 games at DE as a sophomore and was named the team's MVP…Ranked second on the team with 80 tackles and 10.5 sacks, including a streak of seven-consecutive games with at least 1 sack (second-longest streak in school history)…Also led the ACC with 20 TFL (fourth best in the nation) and collected 3 FFs and 1 FR
  • Appeared in all 12 games (one start) as a freshman, totaling 35 tackles, 2.5 sacks and 5.5 TFL
  • Named a two-time All-ACC selection
HIGH SCHOOL
  • Prepped at Denver South (Aurora, CO) HS and was a two-time All-State selection as a DE his junior and senior seasons, while also playing TE (senior)
  • Established a Colorado state record with 57 sacks over his four seasons, with 38 coming in his final two years
  • As a senior, recorded 19 sacks, 188 tackles and 2 INTs on defense…Added 38 receptions for 412 yards and 4 TDs at TE
  • As a junior, recorded a combined 5 TDs off blocked kicks and fumble recoveries in addition to his 19 sacks, 109 tackles and 3 blocked punts
  • Garnered All-State accolades in basketball (junior, 2003) and competed in track and field, qualifying for the state meet in both discus and shot put
COMMUNITY IMPACT
  • Along with his seven siblings, founded the Charles Richard Campbell Foundation, named for and in honor of his father, aimed at supporting disadvantaged youth to reach their full potential...Leads work with the CRC Foundation including the CRC Reading Program, National Guard Kids Camp and Calais' Kroc Stars, in addition to numerous annual fundraising and donation efforts…For more information on Calais' foundation, visit: thecrcfoundation.org/scholarship/
  • Through his foundation, annually awards a $10,000 scholarship to a college-bound African-American high school senior
  • Has donated over $30,000 to Phoenix and Jacksonville-area nonprofits through the Cheer for a Cause program in which the CRC Foundation donates a dollar amount in accordance with Campbell's on-field performance to the charity of a Campbell jersey-wearing fan's choosing
  • In partnership with the Salvation Army Ray & Joan Kroc Center of Phoenix, established the Calais' Kroc Stars after-school program, which provided a multitude of enrichment programs and meals after school for Phoenix-area students
  • Established the CRC After School program, which provides evening activities for Phoenix-area students 5-13, including financial literacy, college preparation, career education and leadership
  • Donated $30,000 to his alma mater, South High School in Denver, to help with the process of switching its nickname from the Rebels to the Ravens...The money will aid in new uniforms, gym flooring and signage throughout the school.
  • Participated in PSA for Ravens' and Leidos' "Tackling Opioid Addiction" campaign (2020-21)
  • Joined students at Coppin Academy High School in Baltimore for a virtual discussion about racism (2020)
  • Partnered with Old Spice and met with local students to discuss the film "Black Boys" (2020)
  • Participated in "Mask on Maryland" Public Service Announcement (2020)
  • Launched the "Charles Richard Campbell Lend-A-Hand Fund" to provide select Baltimore County households with emergency bill assistance (2020)
  • Participated in the Ravens' "Register to Vote" Campaign PSA (2020)
  • Involved in the "Be Safe to Stay Safe" PSA encouraging social distancing and mask wearing during the COVID-19 pandemic (2020)
  • Participated in "Help Tackle Hunger" campaign PSA (2020)
  • Participated in 2020 Draft-a-Thon COVID-19 relief PSA, encouraging fan donations (2020)
  • Participated in live Q&A for 2020 Draft-a-Thon virtual fundraiser (2020)
  • Partnered with CDC Foundation to provide 100 laptops for Baltimore city students (2020)
  • In 2019, received the league's highest community honor, the NFL Water Payton Man of the Year Award...He also earned the 2019 Bart Starr Award for exceptional character, which is voted on by NFL players
  • Gave $1.6 million to his alma mater, the University of Miami, establishing the Calais Campbell Football Defensive Lineman Endowment, a full scholarship for defensive lineman on the Miami football team (2015)
  • Received the 2015 Pop Warner Humanitarian Award
  • Honored as the November 2014 recipient of the NFLPA Community MVP
  • Selected as the Arizona Cardinals Walter Payton Man of the Year (2011, 2014)
  • Had held a number of "Christmas with Calais" holiday shopping events for youth (2012, 2014-16, 2018)
Advertising